Lineage for d1n2aa2 (1n2a A:1-80)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132226Protein Class beta GST [81368] (4 species)
  7. 2132227Species Escherichia coli [TaxId:562] [52883] (3 PDB entries)
  8. 2132228Domain d1n2aa2: 1n2a A:1-80 [91554]
    Other proteins in same PDB: d1n2aa1, d1n2ab1
    complexed with gts

Details for d1n2aa2

PDB Entry: 1n2a (more details), 1.9 Å

PDB Description: Crystal Structure of a Bacterial Glutathione Transferase from Escherichia coli with Glutathione Sulfonate in the Active Site
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1n2aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfavnpkgqvpalllddg
tlltegvaimqyladsvpdr

SCOPe Domain Coordinates for d1n2aa2:

Click to download the PDB-style file with coordinates for d1n2aa2.
(The format of our PDB-style files is described here.)

Timeline for d1n2aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n2aa1