Lineage for d1n2aa2 (1n2a A:1-80)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396080Protein Class beta GST [81368] (3 species)
  7. 396081Species Escherichia coli [TaxId:562] [52883] (3 PDB entries)
  8. 396082Domain d1n2aa2: 1n2a A:1-80 [91554]
    Other proteins in same PDB: d1n2aa1, d1n2ab1

Details for d1n2aa2

PDB Entry: 1n2a (more details), 1.9 Å

PDB Description: Crystal Structure of a Bacterial Glutathione Transferase from Escherichia coli with Glutathione Sulfonate in the Active Site

SCOP Domain Sequences for d1n2aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfavnpkgqvpalllddg
tlltegvaimqyladsvpdr

SCOP Domain Coordinates for d1n2aa2:

Click to download the PDB-style file with coordinates for d1n2aa2.
(The format of our PDB-style files is described here.)

Timeline for d1n2aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n2aa1