Lineage for d1n29a_ (1n29 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361220Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 361221Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 361226Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 361227Protein Phospholipase A2 [48637] (4 species)
  7. 361258Species Human (Homo sapiens), synovial fluid [TaxId:9606] [48638] (12 PDB entries)
  8. 361283Domain d1n29a_: 1n29 A: [91552]
    complexed with ca; mutant

Details for d1n29a_

PDB Entry: 1n29 (more details), 2.6 Å

PDB Description: Crystal structure of the N1A mutant of human group IIA phospholipase A2

SCOP Domain Sequences for d1n29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n29a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid}
alvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvthdccykrlekrgcg
tkflsykfsnsgsritcakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
tprc

SCOP Domain Coordinates for d1n29a_:

Click to download the PDB-style file with coordinates for d1n29a_.
(The format of our PDB-style files is described here.)

Timeline for d1n29a_: