Lineage for d1n1db_ (1n1d B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119181Family c.26.1.2: Cytidylyltransferase [52394] (2 proteins)
    automatically mapped to Pfam PF01467
  6. 2119182Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species)
  7. 2119183Species Bacillus subtilis [TaxId:1423] [52396] (2 PDB entries)
  8. 2119187Domain d1n1db_: 1n1d B: [91539]
    complexed with c2g, so4

Details for d1n1db_

PDB Entry: 1n1d (more details), 2 Å

PDB Description: Glycerol-3-phosphate cytidylyltransferase complexed with CDP-glycerol
PDB Compounds: (B:) glycerol-3-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1n1db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1db_ c.26.1.2 (B:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]}
mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
kikeei

SCOPe Domain Coordinates for d1n1db_:

Click to download the PDB-style file with coordinates for d1n1db_.
(The format of our PDB-style files is described here.)

Timeline for d1n1db_: