SCOP 1.73: Domain d1n0xk2: 1n0x K:114-230

Lineage for d1n0xk2 (1n0x K:114-230)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1n0xk2: 1n0x K:114-230 [91531]
   Other proteins in same PDB: d1n0xh1, d1n0xk1, d1n0xl1, d1n0xl2, d1n0xm1, d1n0xm2
   part of an anti HIV-1 Fab
   complexed with cxs, gol, k, orn, so4

Details for d1n0xk2

PDB Entry: 1n0x, 1.8 Å

PDB Description: crystal structure of a broadly neutralizing anti-hiv-1 antibody in complex with a peptide mimotope

PDB Compounds: (K:) immunoglobulin heavy chain

SCOP Domain Sequences for d1n0xk2:

Sequence, based on SEQRES records:

>d1n0xk2 b.1.1.2 (K:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records):

>d1n0xk2 b.1.1.2 (K:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1n0xk2:

• d1n0xk2 first appeared in SCOP 1.67
  
• d1n0xk2 appears in SCOP 1.71
  
• d1n0xk2 appears in SCOP 1.75
  
• d1n0xk2 appears in the current release, SCOPe 2.08