SCOPe 2.08: Domain d1n0sb_: 1n0s B:

Lineage for d1n0sb_ (1n0s B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Bilin-binding protein [50837] (1 species)

7. Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries)

8. Domain d1n0sb_: 1n0s B: [91527]
   engineered variant flua in complex with fluorescein
   complexed with flu, so4

Details for d1n0sb_

PDB Entry: 1n0s, 2 Å

PDB Description: engineered lipocalin flua in complex with fluorescein

PDB Compounds: (B:) Bilin-binding protein

SCOPe Domain Sequences for d1n0sb_:

Sequence; same for both SEQRES and ATOM records:

>d1n0sb_ b.60.1.1 (B:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}
dvyhdgacpevkpvdnfdwsqyhgkwwevakypspngkygkcgwaeytpegksvkvsryd
vihgkeyfmegtaypvgdskigkiyhsrtvggytrktvfnvlstdnknyiigyscryded
kkghwdhvwvlsrsmvltgeaktavenyligspvvdsqklvysdfseaackvn

Timeline for d1n0sb_:

• d1n0sb_ first appeared in SCOP 1.67
  
• d1n0sb_ appears in SCOPe 2.07