SCOPe 2.08: Domain d1n0gb1: 1n0g B:26-162

Lineage for d1n0gb1 (1n0g B:26-162)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein)
   duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer

6. Protein Hypothetical protein MraZ [102021] (1 species)

7. Species Mycoplasma pneumoniae [TaxId:2104] [102022] (3 PDB entries)

8. Domain d1n0gb1: 1n0g B:26-162 [91525]
   Other proteins in same PDB: d1n0ga2, d1n0gb2
   structural genomics

Details for d1n0gb1

PDB Entry: 1n0g, 2.8 Å

PDB Description: Crystal Structure of A Cell Division and Cell Wall Biosynthesis Protein UPF0040 from Mycoplasma pneumoniae: Indication of A Novel Fold with A Possible New Conserved Sequence Motif

PDB Compounds: (B:) Protein mraZ

SCOPe Domain Sequences for d1n0gb1:

Sequence; same for both SEQRES and ATOM records:

>d1n0gb1 b.129.1.2 (B:26-162) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]}
mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps
tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly
edylansesletvaerm

Timeline for d1n0gb1:

• d1n0gb1 first appeared in SCOP 1.67, called d1n0gb_
  
• d1n0gb1 appears in SCOPe 2.07