Lineage for d1n0ga1 (1n0g A:26-162)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824469Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2824470Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 2824481Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein)
    duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer
  6. 2824482Protein Hypothetical protein MraZ [102021] (1 species)
  7. 2824483Species Mycoplasma pneumoniae [TaxId:2104] [102022] (3 PDB entries)
  8. 2824492Domain d1n0ga1: 1n0g A:26-162 [91524]
    Other proteins in same PDB: d1n0ga2, d1n0gb2
    structural genomics

Details for d1n0ga1

PDB Entry: 1n0g (more details), 2.8 Å

PDB Description: Crystal Structure of A Cell Division and Cell Wall Biosynthesis Protein UPF0040 from Mycoplasma pneumoniae: Indication of A Novel Fold with A Possible New Conserved Sequence Motif
PDB Compounds: (A:) Protein mraZ

SCOPe Domain Sequences for d1n0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0ga1 b.129.1.2 (A:26-162) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]}
mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps
tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly
edylansesletvaerm

SCOPe Domain Coordinates for d1n0ga1:

Click to download the PDB-style file with coordinates for d1n0ga1.
(The format of our PDB-style files is described here.)

Timeline for d1n0ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n0ga2