Class b: All beta proteins [48724] (177 folds) |
Fold b.129: Double-split beta-barrel [89446] (2 superfamilies) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) members of this superfamily are known or predicted to have DNA-binding function |
Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein) duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer |
Protein Hypothetical protein MraZ [102021] (1 species) |
Species Mycoplasma pneumoniae [TaxId:2104] [102022] (3 PDB entries) |
Domain d1n0fc_: 1n0f C: [91518] Other proteins in same PDB: d1n0fa2, d1n0fb2 structural genomics |
PDB Entry: 1n0f (more details), 2.8 Å
SCOPe Domain Sequences for d1n0fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0fc_ b.129.1.2 (C:) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]} mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly edylansesletvaerm
Timeline for d1n0fc_: