Lineage for d1n0eh_ (1n0e H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824469Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2824470Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 2824481Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein)
    duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer
  6. 2824482Protein Hypothetical protein MraZ [102021] (1 species)
  7. 2824483Species Mycoplasma pneumoniae [TaxId:2104] [102022] (3 PDB entries)
  8. 2824491Domain d1n0eh_: 1n0e H: [91515]
    Other proteins in same PDB: d1n0ea2, d1n0eb2, d1n0ee2, d1n0ef2, d1n0eg2
    structural genomics

Details for d1n0eh_

PDB Entry: 1n0e (more details), 2.7 Å

PDB Description: crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif
PDB Compounds: (H:) Protein mraZ

SCOPe Domain Sequences for d1n0eh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0eh_ b.129.1.2 (H:) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]}
mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps
tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly
edylansesletvaerm

SCOPe Domain Coordinates for d1n0eh_:

Click to download the PDB-style file with coordinates for d1n0eh_.
(The format of our PDB-style files is described here.)

Timeline for d1n0eh_: