![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.129: Double-split beta-barrel [89446] (2 superfamilies) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) ![]() members of this superfamily are known or predicted to have DNA-binding function |
![]() | Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein) duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer |
![]() | Protein Hypothetical protein MraZ [102021] (1 species) |
![]() | Species Mycoplasma pneumoniae [TaxId:2104] [102022] (3 PDB entries) |
![]() | Domain d1n0ed_: 1n0e D: [91511] Other proteins in same PDB: d1n0ea2, d1n0eb2, d1n0ee2, d1n0ef2, d1n0eg2 structural genomics |
PDB Entry: 1n0e (more details), 2.7 Å
SCOPe Domain Sequences for d1n0ed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0ed_ b.129.1.2 (D:) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]} mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly edylansesletvaerm
Timeline for d1n0ed_: