SCOP 1.67: Domain d1n0ea_: 1n0e A:

Lineage for d1n0ea_ (1n0e A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.129: MazE/MraZ-like [89446] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: MazE/MraZ-like [89447] (2 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein)
   duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer

6. Protein Hypothetical protein MraZ [102021] (1 species)

7. Species Mycoplasma preumoniae [102022] (3 PDB entries)

8. Domain d1n0ea_: 1n0e A: [91508]

Details for d1n0ea_

PDB Entry: 1n0e, 2.7 Å

PDB Description: crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif

SCOP Domain Sequences for d1n0ea_:

Sequence; same for both SEQRES and ATOM records:

>d1n0ea_ b.129.1.2 (A:) Hypothetical protein MraZ {Mycoplasma preumoniae}
fqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfn
sfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwd
kklyedylansesletvaerm

Timeline for d1n0ea_:

• d1n0ea_ is new in SCOP 1.67
  
• d1n0ea_ appears in SCOP 1.69
  
• d1n0ea_ appears in the current release, SCOPe 2.08, called d1n0ea1