Lineage for d1mzrb1 (1mzr B:3-276)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2437820Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species)
  7. 2437825Species Escherichia coli [TaxId:562] [102053] (1 PDB entry)
  8. 2437827Domain d1mzrb1: 1mzr B:3-276 [91501]
    Other proteins in same PDB: d1mzrb2
    complexed with gol, po4

Details for d1mzrb1

PDB Entry: 1mzr (more details), 2.13 Å

PDB Description: Structure of dkga from E.coli at 2.13 A resolution solved by molecular replacement
PDB Compounds: (B:) 2,5-diketo-D-gluconate reductase A

SCOPe Domain Sequences for d1mzrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzrb1 c.1.7.1 (B:3-276) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]}
anptviklqdgnvmpqlglgvwqasneevitaiqkalevgyrsidtaaaykneegvgkal
knasvnreelfittklwnddhkrprealldslkklqldyidlylmhwpvpaidhyveawk
gmielqkegliksigvcnfqihhlqrlidetgvtpvinqielhplmqqrqlhawnathki
qteswsplaqggkgvfdqkvirdladkygktpaqivirwhldsglvvipksvtpsriaen
fdvwdfrldkdelgeiakldqgkrlgpdpdqfgg

SCOPe Domain Coordinates for d1mzrb1:

Click to download the PDB-style file with coordinates for d1mzrb1.
(The format of our PDB-style files is described here.)

Timeline for d1mzrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mzrb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1mzra_