Lineage for d1mzrb_ (1mzr B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570948Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 570949Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 570950Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species)
  7. 570955Species Escherichia coli [TaxId:562] [102053] (1 PDB entry)
  8. 570957Domain d1mzrb_: 1mzr B: [91501]
    complexed with gol, po4

Details for d1mzrb_

PDB Entry: 1mzr (more details), 2.13 Å

PDB Description: Structure of dkga from E.coli at 2.13 A resolution solved by molecular replacement

SCOP Domain Sequences for d1mzrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzrb_ c.1.7.1 (B:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli}
glanptviklqdgnvmpqlglgvwqasneevitaiqkalevgyrsidtaaaykneegvgk
alknasvnreelfittklwnddhkrprealldslkklqldyidlylmhwpvpaidhyvea
wkgmielqkegliksigvcnfqihhlqrlidetgvtpvinqielhplmqqrqlhawnath
kiqteswsplaqggkgvfdqkvirdladkygktpaqivirwhldsglvvipksvtpsria
enfdvwdfrldkdelgeiakldqgkrlgpdpdqfgg

SCOP Domain Coordinates for d1mzrb_:

Click to download the PDB-style file with coordinates for d1mzrb_.
(The format of our PDB-style files is described here.)

Timeline for d1mzrb_: