![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins) Common fold covers whole protein structure |
![]() | Protein 2,5-diketo-D-gluconic acid reductase A [51443] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [102053] (1 PDB entry) |
![]() | Domain d1mzrb_: 1mzr B: [91501] |
PDB Entry: 1mzr (more details), 2.13 Å
SCOP Domain Sequences for d1mzrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzrb_ c.1.7.1 (B:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli} glanptviklqdgnvmpqlglgvwqasneevitaiqkalevgyrsidtaaaykneegvgk alknasvnreelfittklwnddhkrprealldslkklqldyidlylmhwpvpaidhyvea wkgmielqkegliksigvcnfqihhlqrlidetgvtpvinqielhplmqqrqlhawnath kiqteswsplaqggkgvfdqkvirdladkygktpaqivirwhldsglvvipksvtpsria enfdvwdfrldkdelgeiakldqgkrlgpdpdqfgg
Timeline for d1mzrb_: