Lineage for d1mzra_ (1mzr A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2437820Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species)
  7. 2437825Species Escherichia coli [TaxId:562] [102053] (1 PDB entry)
  8. 2437826Domain d1mzra_: 1mzr A: [91500]
    Other proteins in same PDB: d1mzrb2
    complexed with gol, po4

Details for d1mzra_

PDB Entry: 1mzr (more details), 2.13 Å

PDB Description: Structure of dkga from E.coli at 2.13 A resolution solved by molecular replacement
PDB Compounds: (A:) 2,5-diketo-D-gluconate reductase A

SCOPe Domain Sequences for d1mzra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]}
anptviklqdgnvmpqlglgvwqasneevitaiqkalevgyrsidtaaaykneegvgkal
knasvnreelfittklwnddhkrprealldslkklqldyidlylmhwpvpaidhyveawk
gmielqkegliksigvcnfqihhlqrlidetgvtpvinqielhplmqqrqlhawnathki
qteswsplaqggkgvfdqkvirdladkygktpaqivirwhldsglvvipksvtpsriaen
fdvwdfrldkdelgeiakldqgkrlgpdpdqfgg

SCOPe Domain Coordinates for d1mzra_:

Click to download the PDB-style file with coordinates for d1mzra_.
(The format of our PDB-style files is described here.)

Timeline for d1mzra_: