Lineage for d1mzka_ (1mzk A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371023Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 371024Superfamily b.26.1: SMAD/FHA domain [49879] (3 families) (S)
    has a few short helices inserted in loops
  5. 371052Family b.26.1.2: FHA domain [49885] (7 proteins)
  6. 371070Protein Kinase associated protein phosphatase [101622] (1 species)
  7. 371071Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101623] (1 PDB entry)
  8. 371072Domain d1mzka_: 1mzk A: [91499]

Details for d1mzka_

PDB Entry: 1mzk (more details)

PDB Description: nmr structure of kinase-interacting fha domain of kinase associated protein phosphatase, kapp in arabidopsis

SCOP Domain Sequences for d1mzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana)}
lgsswlfleviagpaiglqhavnstsssklpvklgrvspsdlalkdsevsgkhaqitwns
tkfkwelvdmgslngtlvnshsishpdlgsrkwgnpvelasddiitlgtttkvyvrissq
ne

SCOP Domain Coordinates for d1mzka_:

Click to download the PDB-style file with coordinates for d1mzka_.
(The format of our PDB-style files is described here.)

Timeline for d1mzka_: