Lineage for d1mzba_ (1mzb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983780Family a.4.5.42: FUR-like [101027] (1 protein)
    contains extra N-terminal helix and an alpha+beta dimerisation subdomain
    automatically mapped to Pfam PF01475
  6. 1983781Protein Ferric uptake regulation protein, FUR [101028] (1 species)
  7. 1983782Species Pseudomonas aeruginosa [TaxId:287] [101029] (1 PDB entry)
  8. 1983783Domain d1mzba_: 1mzb A: [91497]
    complexed with zn

Details for d1mzba_

PDB Entry: 1mzb (more details), 1.8 Å

PDB Description: ferric uptake regulator
PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d1mzba_:

Sequence, based on SEQRES records: (download)

>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]}
mvenselrkaglkvtlprvkilqmldsaeqrhmsaedvykalmeagedvglatvyrvltq
feaaglvvrhnfdgghavfeladsghhdhmvcvdtgeviefmdaeiekrqkeivrergfe
lvdhnlvlyvrkkk

Sequence, based on observed residues (ATOM records): (download)

>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]}
mvenselrkaglkvtlprvkilqmldsaqrhmsaedvykalmeagedvglatvyrvltqf
eaaglvvrhnfdgghavfeladsghhdhmvcvdtgeviefmdaeiekrqkeivrergfel
vdhnlvlyvrkkk

SCOPe Domain Coordinates for d1mzba_:

Click to download the PDB-style file with coordinates for d1mzba_.
(The format of our PDB-style files is described here.)

Timeline for d1mzba_: