Lineage for d1mz4a_ (1mz4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304309Protein Cytochrome c550 [100991] (3 species)
  7. 2304310Species Thermosynechococcus elongatus [TaxId:146786] [100992] (1 PDB entry)
  8. 2304311Domain d1mz4a_: 1mz4 A: [91496]
    complexed with bct, gol, hem, po4

Details for d1mz4a_

PDB Entry: 1mz4 (more details), 1.8 Å

PDB Description: crystal structure of cytochrome c550 from thermosynechococcus elongatus
PDB Compounds: (A:) cytochrome c550

SCOPe Domain Sequences for d1mz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mz4a_ a.3.1.1 (A:) Cytochrome c550 {Thermosynechococcus elongatus [TaxId: 146786]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwg

SCOPe Domain Coordinates for d1mz4a_:

Click to download the PDB-style file with coordinates for d1mz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1mz4a_: