SCOPe 2.06: Domain d1mwwa_: 1mww A:

Lineage for d1mwwa_ (1mww A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.4: Hypothetical protein HI1388.1 [103098] (1 protein)
   lacks the N-terminal proline

6. Protein Hypothetical protein HI1388.1 [103099] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [103100] (1 PDB entry)

8. Domain d1mwwa_: 1mww A: [91483]
   structural genomics
   complexed with cl, glu

Details for d1mwwa_

PDB Entry: 1mww, 2.08 Å

PDB Description: the structure of the hypothetical protein hi1388.1 from haemophilus influenzae reveals a tautomerase/mif fold

PDB Compounds: (A:) hypothetical protein hi1388.1

SCOPe Domain Sequences for d1mwwa_:

Sequence; same for both SEQRES and ATOM records:

>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]}
mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt
vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdear

Timeline for d1mwwa_:

• d1mwwa_ first appeared in SCOP 1.67
  
• d1mwwa_ appears in SCOPe 2.05
  
• d1mwwa_ appears in SCOPe 2.07
  
• d1mwwa_ appears in the current release, SCOPe 2.08