![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.4: Hypothetical protein HI1388.1 [103098] (1 protein) lacks the N-terminal proline |
![]() | Protein Hypothetical protein HI1388.1 [103099] (1 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [103100] (1 PDB entry) |
![]() | Domain d1mwwa_: 1mww A: [91483] structural genomics complexed with cl, glu |
PDB Entry: 1mww (more details), 2.08 Å
SCOPe Domain Sequences for d1mwwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdear
Timeline for d1mwwa_: