Lineage for d1mwwa_ (1mww A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915130Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1915131Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1915566Family d.80.1.4: Hypothetical protein HI1388.1 [103098] (1 protein)
    lacks the N-terminal proline
  6. 1915567Protein Hypothetical protein HI1388.1 [103099] (1 species)
  7. 1915568Species Haemophilus influenzae [TaxId:727] [103100] (1 PDB entry)
  8. 1915569Domain d1mwwa_: 1mww A: [91483]
    structural genomics
    complexed with cl, glu

Details for d1mwwa_

PDB Entry: 1mww (more details), 2.08 Å

PDB Description: the structure of the hypothetical protein hi1388.1 from haemophilus influenzae reveals a tautomerase/mif fold
PDB Compounds: (A:) hypothetical protein hi1388.1

SCOPe Domain Sequences for d1mwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]}
mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddyt
vieinlmagrmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdear

SCOPe Domain Coordinates for d1mwwa_:

Click to download the PDB-style file with coordinates for d1mwwa_.
(The format of our PDB-style files is described here.)

Timeline for d1mwwa_: