Lineage for d1mw5a1 (1mw5 A:3-156)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.259: Hypothetical protein HI1480 [103276] (1 superfamily)
    beta-alpha(4)-beta-alpha-beta; segregated alpha-helical and beta-sheet subdomains; dimeric beta-sheet barrel: n=6, S=10
  4. Superfamily d.259.1: Hypothetical protein HI1480 [103277] (1 family) (S)
  5. Family d.259.1.1: Hypothetical protein HI1480 [103278] (1 protein)
  6. Protein Hypothetical protein HI1480 [103279] (1 species)
  7. Species Haemophilus influenzae [TaxId:727] [103280] (1 PDB entry)
    structural genomics
  8. Domain d1mw5a1: 1mw5 A:3-156 [91477]
    Other proteins in same PDB: d1mw5a2, d1mw5b2

Details for d1mw5a1

PDB Entry: 1mw5 (more details), 2.1 Å

PDB Description: structure of hi1480 from haemophilus influenzae
PDB Compounds: (A:) hypothetical protein hi1480

SCOPe Domain Sequences for d1mw5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mw5a1 d.259.1.1 (A:3-156) Hypothetical protein HI1480 {Haemophilus influenzae [TaxId: 727]}
etdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflkfaqal
pahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldlsnlpap
fyvllpesfaaritllvqdkalpyvrvsmeywha

SCOPe Domain Coordinates for d1mw5a1 are not available.

Timeline for d1mw5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mw5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1mw5b1, d1mw5b2