Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Cratylia mollis, isoform 1 [TaxId:252530] [101633] (1 PDB entry) natural circle permutation resulting from a post-translational modification of precursor |
Domain d1mvqa_: 1mvq A: [91473] complexed with ca, mma, mn |
PDB Entry: 1mvq (more details), 1.77 Å
SCOPe Domain Sequences for d1mvqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mvqa_ b.29.1.1 (A:) Legume lectin {Cratylia mollis, isoform 1 [TaxId: 252530]} adtivaveldtypntdigdpsyqhiginiksirskattrwdvqngkvgtahisynsvakr lsavvsypggssatvsydvdlnnilpewvrvglsastglyketntilswsftsklksnst adaqslhftfnqfsqspkdlilqgdastdsdgnlqltrvsngspqsdsvgralyyapvhi wdksavvasfdatftflikspdreiadgiaffiantdssiphgsggrllglfpdan
Timeline for d1mvqa_: