Lineage for d1mv5d_ (1mv5 D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394686Family c.37.1.12: ABC transporter ATPase domain-like [52686] (16 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 394790Protein Multidrug resistance ABC transporter LmrA, C-terminal domain [102381] (1 species)
  7. 394791Species Lactococcus lactis [TaxId:1358] [102382] (1 PDB entry)
  8. 394795Domain d1mv5d_: 1mv5 D: [91472]
    complexed with adp, atp, mg

Details for d1mv5d_

PDB Entry: 1mv5 (more details), 3.1 Å

PDB Description: crystal structure of lmra atp-binding domain

SCOP Domain Sequences for d1mv5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mv5d_ c.37.1.12 (D:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis}
mlsarhvdfayddseqilrdisfeaqpnsiiafagpsgggkstifsllerfyqptageit
idgqpidnislenwrsqigfvsqdsaimagtirenltyglegdytdedlwqvldlafars
fvenmpdqlntevgergvkisggqrqrlaiaraflrnpkilmldeatasldsesesmvqk
aldslmkgrttlviahrlstivdadkiyfiekgqitgsgkhnelvathplyakyvseqlt
v

SCOP Domain Coordinates for d1mv5d_:

Click to download the PDB-style file with coordinates for d1mv5d_.
(The format of our PDB-style files is described here.)

Timeline for d1mv5d_: