Lineage for d1mv5c_ (1mv5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870331Protein Multidrug resistance ABC transporter LmrA, C-terminal domain [102381] (1 species)
  7. 2870332Species Lactococcus lactis [TaxId:1358] [102382] (1 PDB entry)
  8. 2870335Domain d1mv5c_: 1mv5 C: [91471]
    complexed with adp, atp, mg

Details for d1mv5c_

PDB Entry: 1mv5 (more details), 3.1 Å

PDB Description: crystal structure of lmra atp-binding domain
PDB Compounds: (C:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOPe Domain Sequences for d1mv5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mv5c_ c.37.1.12 (C:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}
mlsarhvdfayddseqilrdisfeaqpnsiiafagpsgggkstifsllerfyqptageit
idgqpidnislenwrsqigfvsqdsaimagtirenltyglegdytdedlwqvldlafars
fvenmpdqlntevgergvkisggqrqrlaiaraflrnpkilmldeatasldsesesmvqk
aldslmkgrttlviahrlstivdadkiyfiekgqitgsgkhnelvathplyakyvseqlt
vg

SCOPe Domain Coordinates for d1mv5c_:

Click to download the PDB-style file with coordinates for d1mv5c_.
(The format of our PDB-style files is described here.)

Timeline for d1mv5c_: