SCOPe 2.08: Domain d1mv5a_: 1mv5 A:

Lineage for d1mv5a_ (1mv5 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Multidrug resistance ABC transporter LmrA, C-terminal domain [102381] (1 species)

7. Species Lactococcus lactis [TaxId:1358] [102382] (1 PDB entry)

8. Domain d1mv5a_: 1mv5 A: [91469]
   complexed with adp, atp, mg

Details for d1mv5a_

PDB Entry: 1mv5, 3.1 Å

PDB Description: crystal structure of lmra atp-binding domain

PDB Compounds: (A:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOPe Domain Sequences for d1mv5a_:

Sequence; same for both SEQRES and ATOM records:

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}
mlsarhvdfayddseqilrdisfeaqpnsiiafagpsgggkstifsllerfyqptageit
idgqpidnislenwrsqigfvsqdsaimagtirenltyglegdytdedlwqvldlafars
fvenmpdqlntevgergvkisggqrqrlaiaraflrnpkilmldeatasldsesesmvqk
aldslmkgrttlviahrlstivdadkiyfiekgqitgsgkhnelvathplyakyvseqlt
vg

Timeline for d1mv5a_:

• d1mv5a_ first appeared in SCOP 1.67
  
• d1mv5a_ appears in SCOPe 2.07