Class b: All beta proteins [48724] (141 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (33 proteins) |
Protein Amphiphysin 2 [50080] (1 species) synonyms: Myc box dependent interacting protein 1, bin1 |
Species Rat (Rattus norvegicus) [TaxId:10116] [50081] (4 PDB entries) |
Domain d1mv3a1: 1mv3 A:402-482 [91468] the remaining residues, 270-401 are not ordered apart a short bound segment 303-312 |
PDB Entry: 1mv3 (more details)
SCOP Domain Sequences for d1mv3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mv3a1 b.34.2.1 (A:402-482) Amphiphysin 2 {Rat (Rattus norvegicus)} grldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesdwn qhkklekcrgvfpenftervp
Timeline for d1mv3a1: