Lineage for d1mv3a1 (1mv3 A:402-482)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377020Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2377084Protein Amphiphysin 2 [50080] (1 species)
    synonyms: Myc box dependent interacting protein 1, bin1
  7. 2377085Species Norway rat (Rattus norvegicus) [TaxId:10116] [50081] (4 PDB entries)
  8. 2377089Domain d1mv3a1: 1mv3 A:402-482 [91468]
    the remaining residues, 270-401 are not ordered apart a short bound segment 303-312

Details for d1mv3a1

PDB Entry: 1mv3 (more details)

PDB Description: nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
PDB Compounds: (A:) Myc box dependent interacting protein 1

SCOPe Domain Sequences for d1mv3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mv3a1 b.34.2.1 (A:402-482) Amphiphysin 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
grldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesdwn
qhkklekcrgvfpenftervp

SCOPe Domain Coordinates for d1mv3a1:

Click to download the PDB-style file with coordinates for d1mv3a1.
(The format of our PDB-style files is described here.)

Timeline for d1mv3a1: