Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Amphiphysin 2 [50080] (1 species) synonyms: Myc box dependent interacting protein 1, bin1 |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [50081] (4 PDB entries) |
Domain d1mv0b_: 1mv0 B: [91467] complexed with c-Myc peptide, chain A |
PDB Entry: 1mv0 (more details)
SCOPe Domain Sequences for d1mv0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mv0b_ b.34.2.1 (B:) Amphiphysin 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} grldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesdwn qhkklekcrgvfpenftervp
Timeline for d1mv0b_: