Lineage for d1mula_ (1mul A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323932Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2323933Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2323934Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 protein domains)
    automatically mapped to Pfam PF00216
  6. 2323935Protein HU protein [47735] (5 species)
  7. 2323951Species Escherichia coli [TaxId:562] [101230] (2 PDB entries)
  8. 2323952Domain d1mula_: 1mul A: [91465]
    alpha2 isoform

Details for d1mula_

PDB Entry: 1mul (more details), 2.3 Å

PDB Description: Crystal structure of the E. coli HU alpha2 protein
PDB Compounds: (A:) DNA binding protein HU-alpha

SCOPe Domain Sequences for d1mula_:

Sequence, based on SEQRES records: (download)

>d1mula_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]}
mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhraertg
rnpqtgkeikiaaanvpafvsgkalkdavk

Sequence, based on observed residues (ATOM records): (download)

>d1mula_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]}
mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhraeaaa
nvpafvsgkalkdavk

SCOPe Domain Coordinates for d1mula_:

Click to download the PDB-style file with coordinates for d1mula_.
(The format of our PDB-style files is described here.)

Timeline for d1mula_: