Lineage for d1mu4b1 (1mu4 B:1-85)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572528Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2572529Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2572530Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2572531Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 2572532Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)
  8. 2572538Domain d1mu4b1: 1mu4 B:1-85 [91461]
    Other proteins in same PDB: d1mu4a2, d1mu4b2
    N-terminal strand-swapped dimer
    complexed with so4

Details for d1mu4b1

PDB Entry: 1mu4 (more details), 1.8 Å

PDB Description: crystal structure at 1.8 angstroms of the bacillus subtilis catabolite repression histidine containing protein (crh)
PDB Compounds: (B:) HPr-like protein crh

SCOPe Domain Sequences for d1mu4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mu4b1 d.94.1.1 (B:1-85) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeev

SCOPe Domain Coordinates for d1mu4b1:

Click to download the PDB-style file with coordinates for d1mu4b1.
(The format of our PDB-style files is described here.)

Timeline for d1mu4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mu4b2