SCOP 1.67: Domain d1mu4b_: 1mu4 B:

Lineage for d1mu4b_ (1mu4 B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Crh, catabolite repression HPr-like protein [69783] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [69784] (3 PDB entries)

8. Domain d1mu4b_: 1mu4 B: [91461]
   N-terminal strand-swapped dimer
   complexed with so4

Details for d1mu4b_

PDB Entry: 1mu4, 1.8 Å

PDB Description: crystal structure at 1.8 angstroms of the bacillus subtilis catabolite repression histidine containing protein (crh)

SCOP Domain Sequences for d1mu4b_:

Sequence; same for both SEQRES and ATOM records:

>d1mu4b_ d.94.1.1 (B:) Crh, catabolite repression HPr-like protein {Bacillus subtilis}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq

Timeline for d1mu4b_:

• d1mu4b_ is new in SCOP 1.67
  
• d1mu4b_ appears in SCOP 1.69
  
• d1mu4b_ appears in the current release, SCOPe 2.08, called d1mu4b1