Lineage for d1mrza2 (1mrz A:2-158)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 579982Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 580134Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)
  6. 580149Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)
  7. 580150Species Thermotoga maritima [TaxId:243274] [102261] (5 PDB entries)
    TM0379
  8. 580151Domain d1mrza2: 1mrz A:2-158 [91453]
    Other proteins in same PDB: d1mrza1, d1mrzb1

Details for d1mrza2

PDB Entry: 1mrz (more details), 1.9 Å

PDB Description: crystal structure of a flavin binding protein from thermotoga maritima, tm379

SCOP Domain Sequences for d1mrza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr

SCOP Domain Coordinates for d1mrza2:

Click to download the PDB-style file with coordinates for d1mrza2.
(The format of our PDB-style files is described here.)

Timeline for d1mrza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrza1