Lineage for d1mrza1 (1mrz A:159-288)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375649Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 375882Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) (S)
  5. 375883Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins)
  6. 375898Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)
  7. 375899Species Thermotoga maritima [TaxId:243274] [101787] (1 PDB entry)
    TM0379
  8. 375900Domain d1mrza1: 1mrz A:159-288 [91452]
    Other proteins in same PDB: d1mrza2, d1mrzb2

Details for d1mrza1

PDB Entry: 1mrz (more details), 1.9 Å

PDB Description: crystal structure of a flavin binding protein from thermotoga maritima, tm379

SCOP Domain Sequences for d1mrza1:

Sequence, based on SEQRES records: (download)

>d1mrza1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinsk

Sequence, based on observed residues (ATOM records): (download)

>d1mrza1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima}
yfeiegivfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrrnvkyevyil
dfegdlygqrlklevlkfmrdekkeelkaaidqdvksarnmiddiinsk

SCOP Domain Coordinates for d1mrza1:

Click to download the PDB-style file with coordinates for d1mrza1.
(The format of our PDB-style files is described here.)

Timeline for d1mrza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrza2