SCOP 1.67: Domain d1mrxb_: 1mrx B:

Lineage for d1mrxb_ (1mrx B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (160 PDB entries)

8. Domain d1mrxb_: 1mrx B: [91450]
   complexed with k57; mutant

Details for d1mrxb_

PDB Entry: 1mrx, 2 Å

PDB Description: structure of hiv protease (mutant q7k l33i l63i v82f i84v ) complexed with kni-577

SCOP Domain Sequences for d1mrxb_:

Sequence; same for both SEQRES and ATOM records:

>d1mrxb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpfnvigrnlltqigctlnf

Timeline for d1mrxb_:

• d1mrxb_ is new in SCOP 1.67
  
• d1mrxb_ appears in SCOP 1.69
  
• d1mrxb_ appears in the current release, SCOPe 2.08