Lineage for d1mrqa_ (1mrq A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473932Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 473933Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 473942Protein 20alpha-hydroxysteroid dehydrogenase [109609] (2 species)
  7. 473943Species Human (Homo sapiens) [TaxId:9606] [109610] (1 PDB entry)
  8. 473944Domain d1mrqa_: 1mrq A: [91445]

Details for d1mrqa_

PDB Entry: 1mrq (more details), 1.59 Å

PDB Description: crystal structure of human 20alpha-hsd in ternary complex with nadp and 20alpha-hydroxy-progesterone

SCOP Domain Sequences for d1mrqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrqa_ c.1.7.1 (A:) 20alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens)}
qdskyqcvklndghfmpvlgfgtyapaevpkskaleatklaieagfrhidsahlynneeq
vglairskiadgsvkredifytsklwcnshrpelvrpalerslknlqldyvdlylihfpv
svkpgeevipkdengkilfdtvdlcatweavekckdaglaksigvsnfnrrqlemilnkp
glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
rnvryltldifagppnypfsdey

SCOP Domain Coordinates for d1mrqa_:

Click to download the PDB-style file with coordinates for d1mrqa_.
(The format of our PDB-style files is described here.)

Timeline for d1mrqa_: