SCOPe 2.08: Domain d1mrqa1: 1mrq A:2-323

Lineage for d1mrqa1 (1mrq A:2-323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein 20alpha-hydroxysteroid dehydrogenase [109609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109610] (1 PDB entry)

8. Domain d1mrqa1: 1mrq A:2-323 [91445]
   Other proteins in same PDB: d1mrqa2
   complexed with bme, nap, str

Details for d1mrqa1

PDB Entry: 1mrq, 1.59 Å

PDB Description: crystal structure of human 20alpha-hsd in ternary complex with nadp and 20alpha-hydroxy-progesterone

PDB Compounds: (A:) Aldo-keto reductase family 1 member C1

SCOPe Domain Sequences for d1mrqa1:

Sequence; same for both SEQRES and ATOM records:

>d1mrqa1 c.1.7.1 (A:2-323) 20alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
dskyqcvklndghfmpvlgfgtyapaevpkskaleatklaieagfrhidsahlynneeqv
glairskiadgsvkredifytsklwcnshrpelvrpalerslknlqldyvdlylihfpvs
vkpgeevipkdengkilfdtvdlcatweavekckdaglaksigvsnfnrrqlemilnkpg
lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
nvryltldifagppnypfsdey

Timeline for d1mrqa1:

• d1mrqa1 first appeared in SCOP 1.67, called d1mrqa_
  
• d1mrqa1 appears in SCOPe 2.07