SCOPe 2.06: Domain d1mrlc_: 1mrl C:

Lineage for d1mrlc_ (1mrl C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein Xenobiotic acetyltransferase [51169] (2 species)

7. Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (8 PDB entries)
   streptogramin A acetyltransferase

8. Domain d1mrlc_: 1mrl C: [91444]
   complexed with dol

Details for d1mrlc_

PDB Entry: 1mrl, 2.8 Å

PDB Description: Crystal structure of streptogramin A acetyltransferase with dalfopristin

PDB Compounds: (C:) streptogramin a acetyltransferase

SCOPe Domain Sequences for d1mrlc_:

Sequence; same for both SEQRES and ATOM records:

>d1mrlc_ b.81.1.3 (C:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}
mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
wwnwpidiinenidkildnsiire

Timeline for d1mrlc_:

• d1mrlc_ first appeared in SCOP 1.67
  
• d1mrlc_ appears in SCOPe 2.05
  
• d1mrlc_ appears in SCOPe 2.07
  
• d1mrlc_ appears in the current release, SCOPe 2.08