Lineage for d1mr9z_ (1mr9 Z:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403254Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 protein domains)
  6. 2403274Protein Xenobiotic acetyltransferase [51169] (2 species)
  7. 2403275Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (8 PDB entries)
    streptogramin A acetyltransferase
  8. 2403317Domain d1mr9z_: 1mr9 Z: [91441]
    complexed with aco

Details for d1mr9z_

PDB Entry: 1mr9 (more details), 3 Å

PDB Description: Crystal structure of Streptogramin A Acetyltransferase with acetyl-CoA bound
PDB Compounds: (Z:) streptogramin a acetyltransferase

SCOPe Domain Sequences for d1mr9z_:

Sequence, based on SEQRES records: (download)

>d1mr9z_ b.81.1.3 (Z:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}
gpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndkl
kigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndvw
igkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldikw
wnwpidiinenidkildnsii

Sequence, based on observed residues (ATOM records): (download)

>d1mr9z_ b.81.1.3 (Z:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}
gpnpmkmypiegnksvqfikpillenvevgeysyydskngetfdkqilyhypilndklki
gkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndvwig
kdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldikwwn
wpidiinenidkildnsii

SCOPe Domain Coordinates for d1mr9z_:

Click to download the PDB-style file with coordinates for d1mr9z_.
(The format of our PDB-style files is described here.)

Timeline for d1mr9z_: