SCOPe 2.05: Domain d1mr7z_: 1mr7 Z:

Lineage for d1mr7z_ (1mr7 Z:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein Xenobiotic acetyltransferase [51169] (2 species)

7. Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (8 PDB entries)
   streptogramin A acetyltransferase

8. Domain d1mr7z_: 1mr7 Z: [91435]

Details for d1mr7z_

PDB Entry: 1mr7, 1.8 Å

PDB Description: Crystal Structure of Streptogramin A Acetyltransferase

PDB Compounds: (Z:) streptogramin a acetyltransferase

SCOPe Domain Sequences for d1mr7z_:

Sequence; same for both SEQRES and ATOM records:

>d1mr7z_ b.81.1.3 (Z:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}
mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
wwnwpidiinenidkildnsiir

Timeline for d1mr7z_:

• d1mr7z_ first appeared in SCOP 1.67
  
• d1mr7z_ appears in SCOPe 2.04
  
• d1mr7z_ appears in SCOPe 2.06
  
• d1mr7z_ appears in the current release, SCOPe 2.08