SCOPe 2.02: Domain d1mqt.1: 1mqt D:,B:

Lineage for d1mqt.1 (1mqt D:,B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Swine vesicular disease virus coat proteins [89225] (1 species)

7. Species Swine vesicular disease virus [TaxId:12075] [89226] (2 PDB entries)

8. Domain d1mqt.1: 1mqt D:,B: [91424]
   complexed with spl

Details for d1mqt.1

PDB Entry: 1mqt, 3.3 Å

PDB Description: Swine Vesicular Disease Virus coat protein

PDB Compounds: (B:) Polyprotein Capsid Protein, (D:) Polyprotein Capsid Protein

SCOPe Domain Sequences for d1mqt.1:

Sequence, based on SEQRES records:

>g1mqt.1 b.121.4.1 (D:,B:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus [TaxId: 12075]}
gaqvstqktgahetslnaagnsvihytninyykdaasnsanrqdftqdpgkftepvkdim
vksmpalnXgysdrvrsitlgnstittqecanvvvgygvwpaylkdeeataedqptqpdv
atcrfytlesvmwqqgspgwwwkfpdalsnmglfgqnmqyhylgragytihvqcnaskfh
qgcllvvcvpeaemgcatlankpdpkslskgeiastfesqnstgetavqanvinagmgvg
vgnltifphqwinlrtnnsativmpyinsvpmdnmfrhnnftlmvipfaplsysagatty
vpitvtvapmcaeynglrlagkq

Sequence, based on observed residues (ATOM records):

>g1mqt.1 b.121.4.1 (D:,B:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus [TaxId: 12075]}
gaqvstqktgihytninyykdaasnsanrqdftqdpgkftepvkdimvksmpalnXgysd
rvrsitlgnstittqecanvvvgygvwpaylkdeeataedqptqpdvatcrfytlesvmw
qqgspgwwwkfpdalsnmglfgqnmqyhylgragytihvqcnaskfhqgcllvvcvpeae
mgcatlankpdpkslskgeiastfesqnstgetavqanvinagmgvgvgnltifphqwin
lrtnnsativmpyinsvpmdnmfrhnnftlmvipfaplsysagattyvpitvtvapmcae
ynglrlagkq

Timeline for d1mqt.1:

• d1mqt.1 first appeared in SCOP 1.67
  
• d1mqt.1 appears in SCOPe 2.01
  
• d1mqt.1 appears in SCOPe 2.03
  
• d1mqt.1 appears in the current release, SCOPe 2.08