SCOP 1.75: Domain d1mqqa2: 1mqq A:4-142

Lineage for d1mqqa2 (1mqq A:4-142)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
   family GH67

6. Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
   inverting reaction mechanism

7. Species Bacillus stearothermophilus [TaxId:1422] [82740] (7 PDB entries)

8. Domain d1mqqa2: 1mqq A:4-142 [91421]
   Other proteins in same PDB: d1mqqa1
   complexed with gcu, gol

Details for d1mqqa2

PDB Entry: 1mqq, 1.65 Å

PDB Description: the crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1 complexed with glucuronic acid

PDB Compounds: (A:) alpha-d-glucuronidase

SCOP Domain Sequences for d1mqqa2:

Sequence; same for both SEQRES and ATOM records:

>d1mqqa2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
gyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevnet
ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr
llqmgeniaqlsiieqpkn

Timeline for d1mqqa2:

• d1mqqa2 first appeared in SCOP 1.67
  
• d1mqqa2 appears in SCOP 1.73
  
• d1mqqa2 appears in SCOPe 2.01
  
• d1mqqa2 appears in the current release, SCOPe 2.08