Lineage for d1mqqa2 (1mqq A:4-142)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415854Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 415884Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
  6. 415885Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
    inverting reaction mechanism
  7. 415886Species Bacillus stearothermophilus [TaxId:1422] [82740] (7 PDB entries)
  8. 415888Domain d1mqqa2: 1mqq A:4-142 [91421]
    Other proteins in same PDB: d1mqqa1
    complexed with gcu, gol

Details for d1mqqa2

PDB Entry: 1mqq (more details), 1.65 Å

PDB Description: the crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1 complexed with glucuronic acid

SCOP Domain Sequences for d1mqqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqqa2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus}
gyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevnet
ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr
llqmgeniaqlsiieqpkn

SCOP Domain Coordinates for d1mqqa2:

Click to download the PDB-style file with coordinates for d1mqqa2.
(The format of our PDB-style files is described here.)

Timeline for d1mqqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mqqa1