SCOP 1.75: Domain d1mqqa1: 1mqq A:143-678

Lineage for d1mqqa1 (1mqq A:143-678)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein alpha-D-glucuronidase catalytic domain [82254] (2 species)
   inverting reaction mechanism

7. Species Bacillus stearothermophilus [TaxId:1422] [82256] (7 PDB entries)

8. Domain d1mqqa1: 1mqq A:143-678 [91420]
   Other proteins in same PDB: d1mqqa2
   complexed with gcu, gol

Details for d1mqqa1

PDB Entry: 1mqq, 1.65 Å

PDB Description: the crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1 complexed with glucuronic acid

PDB Compounds: (A:) alpha-d-glucuronidase

SCOP Domain Sequences for d1mqqa1:

Sequence; same for both SEQRES and ATOM records:

>d1mqqa1 c.1.8.10 (A:143-678) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
rlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdyarllasvginaisinnvnv
hktetklitdhflpdvaevadifrtygiktflsinyaspieigglptadpldpevrwwwk
etakriyqyipdfggfvvkadsefrpgpftygrdhaeganmlaealapfgglviwrcfvy
ncqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvrepvsplfgampktn
qmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvidgslfdyrysgiag
vsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfgddsqvvetiswml
lsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrdgigvdrtvatgtg
ytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhiynthfegveqakql
rkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksgiddqygrkiy

Timeline for d1mqqa1:

• d1mqqa1 first appeared in SCOP 1.67
  
• d1mqqa1 appears in SCOP 1.73
  
• d1mqqa1 appears in SCOPe 2.01
  
• d1mqqa1 appears in the current release, SCOPe 2.08