SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1mqng_ (1mqn G:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (113 PDB entries)
  8. 2040645Domain d1mqng_: 1mqn G: [91416]
    Other proteins in same PDB: d1mqnb_, d1mqne_, d1mqnh_
    complexed with gal, nag, sia

Details for d1mqng_

PDB Entry: 1mqn (more details), 3.2 Å

PDB Description: bha/lstc
PDB Compounds: (G:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d1mqng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqng_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpek

SCOPe Domain Coordinates for d1mqng_:

Click to download the PDB-style file with coordinates for d1mqng_.
(The format of our PDB-style files is described here.)

Timeline for d1mqng_: