Lineage for d1mqmh_ (1mqm H:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467362Domain d1mqmh_: 1mqm H: [91411]
    Other proteins in same PDB: d1mqma_, d1mqmd_, d1mqmg_
    complexed with nag

Details for d1mqmh_

PDB Entry: 1mqm (more details), 2.6 Å

PDB Description: bha/lsta
PDB Compounds: (H:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d1mqmh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqmh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq

SCOPe Domain Coordinates for d1mqmh_:

Click to download the PDB-style file with coordinates for d1mqmh_.
(The format of our PDB-style files is described here.)

Timeline for d1mqmh_: