SCOP 1.75: Domain d1mqmh_: 1mqm H:

Lineage for d1mqmh_ (1mqm H:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)

8. Domain d1mqmh_: 1mqm H: [91411]
   Other proteins in same PDB: d1mqma_, d1mqmd_, d1mqmg_
   complexed with gal, man, nag, sia

Details for d1mqmh_

PDB Entry: 1mqm, 2.6 Å

PDB Description: bha/lsta

PDB Compounds: (H:) Hemagglutinin HA2 chain

SCOP Domain Sequences for d1mqmh_:

Sequence; same for both SEQRES and ATOM records:

>d1mqmh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq

Timeline for d1mqmh_:

• d1mqmh_ first appeared in SCOP 1.67
  
• d1mqmh_ appears in SCOP 1.73
  
• d1mqmh_ appears in SCOPe 2.01
  
• d1mqmh_ appears in the current release, SCOPe 2.08