Lineage for d1mqmg_ (1mqm G:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459240Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 459241Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 459286Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 459287Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 459288Species Influenza A virus, different strains [TaxId:11320] [49825] (36 PDB entries)
  8. 459331Domain d1mqmg_: 1mqm G: [91410]
    Other proteins in same PDB: d1mqmb_, d1mqme_, d1mqmh_

Details for d1mqmg_

PDB Entry: 1mqm (more details), 2.6 Å

PDB Description: bha/lsta

SCOP Domain Sequences for d1mqmg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqmg_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains}
statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpek

SCOP Domain Coordinates for d1mqmg_:

Click to download the PDB-style file with coordinates for d1mqmg_.
(The format of our PDB-style files is described here.)

Timeline for d1mqmg_: