SCOPe 2.01: Domain d1mqme_: 1mqm E:

Lineage for d1mqme_ (1mqm E:)

1. Root: SCOPe 2.01

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)

8. Domain d1mqme_: 1mqm E: [91409]
   Other proteins in same PDB: d1mqma_, d1mqmd_, d1mqmg_
   complexed with nag

Details for d1mqme_

PDB Entry: 1mqm, 2.6 Å

PDB Description: bha/lsta

PDB Compounds: (E:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d1mqme_:

Sequence; same for both SEQRES and ATOM records:

>d1mqme_ h.3.1.1 (E:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq

Timeline for d1mqme_:

• d1mqme_ first appeared in SCOP 1.67
  
• d1mqme_ appears in SCOP 1.75
  
• d1mqme_ appears in SCOPe 2.02
  
• d1mqme_ appears in the current release, SCOPe 2.08