![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (2 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries) |
![]() | Domain d1mqlh_: 1mql H: [91405] Other proteins in same PDB: d1mqla_, d1mqld_, d1mqlg_ complexed with man, nag, ndg |
PDB Entry: 1mql (more details), 2.9 Å
SCOPe Domain Sequences for d1mqlh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mqlh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq
Timeline for d1mqlh_: